HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QXU6

Names and origin
Entry : E4QXU6 (unreviewed)
Entry name : E4QXU6_HAEI6
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
ORF names : R2866_0529
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : hydrolase activity, acting on ester bonds; mRNA binding
GO identifier : GO:0016788; GO:0003729
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 80 residues
>E4QXU6|E4QXU6_HAEI6 Haemophilus influenzae R2866
MGIITTIERQEGETVDSKTAIKMIEEDGWYLDRVKGSHHQYKHPTKKGTVTIPHPRKDLG
HLEKSIKKQAGL