HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QXS5

Names and origin
Entry : E4QXS5 (unreviewed)
Entry name : E4QXS5_HAEI6
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
ORF names : R2866_0507
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : gluconate transmembrane transporter activity; membrane
GO identifier : GO:0015128; GO:0016020
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 114 residues
>E4QXS5|E4QXS5_HAEI6 Haemophilus influenzae R2866
MSELLINDYTRKGFVDGLCLRLPTICIRPGKPNKATSSFVSSIIREPLHGETSICPVAEK
MAFSFIKFLGKKKEEWALAITGYVVSIPIVLPILLIFIKVILDLGK