HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QXP1

Names and origin
Entry : E4QXP1 (unreviewed)
Entry name : E4QXP1_HAEI6
Protein names : Protease HtpX (EC 3.4.24.-) (Heat shock protein HtpX)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : htpX
ORF names : R2866_1754
EC number : 3.4.24.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; metalloendopeptidase activity; plasma membrane; proteolysis; response to stress; zinc ion binding
GO identifier : GO:0016021; GO:0004222; GO:0005886; GO:0006508; GO:0006950; GO:0008270
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Hydrolase; Membrane; Metal-binding; Metalloprotease; Protease; Stress response; Transmembrane; Transmembrane helix; Zinc
General annotation
Sequence similarities : Belongs to Peptidase M48B family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 303 residues
>E4QXP1|E4QXP1_HAEI6 Haemophilus influenzae R2866
MMRILLFLATNMAVMLVLGIILSVTGIAGNSTGGILIMALLFGFAGSLISLFLSKTMALR
SVDGEVITQPRNQTERWLIDTVSRQAQKAGIPMPDVAIYHSPDVNAFATGATKSNSLVAV
STGLLNNMTEAEAEAVLAHEISHISNGDMVTMALLQGVLNTFVIFLSRVIATAVASSRNN
NGEETRSSGIYFLVSMVLEMLFGVLASIIAMWFSRYREFRADAGSASLVGKEKMIMALQR
LQQLHEPQNLEGSLNAFMINGKRSELFMSHPPLEKRIEALRNL