HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QXL2

Names and origin
Entry : E4QXL2 (unreviewed)
Entry name : E4QXL2_HAEI6
Protein names : Probable phage baseplate assembly protein W
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : gpW
ORF names : R2866_1718
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : amine metabolic process; copper ion binding; quinone binding
GO identifier : GO:0009308; GO:0005507; GO:0048038
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 120 residues
>E4QXL2|E4QXL2_HAEI6 Haemophilus influenzae R2866
MNRYTGETLKNESDHIKQSIADILLTPVGSRIQRREYGSLIPLLIDRPISHTLLLQLAAC
AVTAINRWEPRVQITQFKPELVEGGIVASYVARSRKDNQEMHNEKLFLGHKQ