HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QXE4

Names and origin
Entry : E4QXE4 (unreviewed)
Entry name : E4QXE4_HAEI6
Protein names : Acyl carrier protein (ACP)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : acpP
ORF names : R2866_0433
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process; cytoplasm
GO identifier : GO:0000036; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Fatty acid biosynthesis; Fatty acid metabolism; Lipid biosynthesis; Lipid metabolism; Phosphopantetheine
General annotation
Domains : Acyl carrier domain (1)
Pathway : Lipid metabolism; fatty acid biosynthesis.
Subcellular location : Cytoplasm.
Protein sequence
Length : 84 residues
>E4QXE4|E4QXE4_HAEI6 Haemophilus influenzae R2866
MSIEERVKKIIVEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE
KITTVQSAIDYVQNNQ