HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QXD5

Names and origin
Entry : E4QXD5 (unreviewed)
Entry name : E4QXD5_HAEI6
Protein names : Morphology-related protein BolA
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : bolA
ORF names : R2866_0424
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to BolA/yrbA family
Protein sequence
Length : 111 residues
>E4QXD5|E4QXD5_HAEI6 Haemophilus influenzae R2866
MSIQQIIEQKIQKEFQPHFLAIENESHLHHSNRGSESHFKCVIVSADFKNIRKVQRHQRI
YQLLNEELNHSIHALALHLFTPEEWKAQNETVPHSTKCAGIGR