HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QX97

Names and origin
Entry : E4QX97 (unreviewed)
Entry name : E4QX97_HAEI6
Protein names : Protein CyaY
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : cyaY
ORF names : R2866_1665
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ferric iron binding; iron-sulfur cluster assembly
GO identifier : GO:0008199; GO:0016226
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to Frataxin family
Protein sequence
Length : 109 residues
>E4QX97|E4QX97_HAEI6 Haemophilus influenzae R2866
MNIAEFHQNIEQVWQKIEEELENQGADVDCETQGSVFTITFDNRTQIVINKQEPLLELWI
ASKLGGFHFAFKNGDWVSNDGQRFWDCFVEACAAHGENVQF