HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QX84

Names and origin
Entry : E4QX84 (unreviewed)
Entry name : E4QX84_HAEI6
Protein names : Protein-export protein SecB
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : secB
ORF names : R2866_1652
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; protein folding; protein tetramerization; protein transport
GO identifier : GO:0005737; GO:0006457; GO:0051262; GO:0015031
Keywords
Ligand & Biological process : Chaperone; Complete proteome; Cytoplasm; Protein transport; Translocation; Transport
General annotation
Sequence similarities : Belongs to SecB family
Subcellular location : Cytoplasm.
Protein sequence
Length : 181 residues
>E4QX84|E4QX84_HAEI6 Haemophilus influenzae R2866
MSEQKQDVAATEEQQPVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGD
DLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYAR
ELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAEEKSEEEQTKH