HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QX77

Names and origin
Entry : E4QX77 (unreviewed)
Entry name : E4QX77_HAEI6
Protein names : Probable thiol peroxidase (EC 1.11.1.-)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : tpx
ORF names : R2866_1645
EC number : 1.11.1.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; thioredoxin peroxidase activity
GO identifier : GO:0045454; GO:0008379
Keywords
Ligand & Biological process : Antioxidant; Complete proteome; Oxidoreductase; Peroxidase
General annotation
Domains : Thioredoxin domain (1)
Sequence similarities : Belongs to AhpC/TSA family, Tpx subfamily
Protein sequence
Length : 177 residues
>E4QX77|E4QX77_HAEI6 Haemophilus influenzae R2866
MTVTLAGNPIEVGGHFPQVGEIVENFILVGNDLADVALNDFAGKRKVLNIFPSIDTGVCA
TSVRKFNQQAAKLSNTIVLCISADLPFAQARFCGAEGIENAKTVSTFRNHALHSQLGVDI
QTGPLAGLTSRAVIVLDEQNNVLHSQLVEEIKEEPNYEAALAVLA