HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QX68

Names and origin
Entry : E4QX68 (unreviewed)
Entry name : E4QX68_HAEI6
Protein names : Probable Fe(2+)-trafficking protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yggX
ORF names : R2866_1636
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : iron ion binding
GO identifier : GO:0005506
Keywords
Ligand & Biological process : Complete proteome; Iron
General annotation
Sequence similarities : Belongs to Fe(2+)-trafficking protein family
Protein sequence
Length : 98 residues
>E4QX68|E4QX68_HAEI6 Haemophilus influenzae R2866
MARTVFCEYLKKEAEGLDFQLYPGELGKRIFDSVSKQAWGEWIKKQTMLVNEKKLNMMNA
EHRKLLEQEMVNFLFEGKDVHIEGYVPPSN