HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E4QX52

Names and origin

Entry	:	E4QX52 (unreviewed)
Entry name	:	E4QX52_HAEI6
Protein names	:	30S ribosomal protein S10
Organism	:	Haemophilus influenzae R2866
Organism ID	:	262728
Gene names	:	rpS10
ORF names	:	rpsJ

History

Date of creation	:	2011-02-08
Date of modification	:	2013-11-13
Date of sequence modification	:	2011-02-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ribosome; structural constituent of ribosome; tRNA binding; translation
GO identifier	:	GO:0005840; GO:0003735; GO:0000049; GO:0006412

Keywords

Ligand & Biological process

Complete proteome; Ribonucleoprotein; Ribosomal protein

General annotation

Sequence similarities

Belongs to Ribosomal protein S10P family

Protein sequence

Length

111 residues

>E4QX52|E4QX52_HAEI6 Haemophilus influenzae R2866
MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD
ARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG