HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E4QX46

Names and origin

Entry	:	E4QX46 (unreviewed)
Entry name	:	E4QX46_HAEI6
Protein names	:	50S ribosomal protein L22
Organism	:	Haemophilus influenzae R2866
Organism ID	:	262728
Gene names	:	rpL22
ORF names	:	rplV

History

Date of creation	:	2011-02-08
Date of modification	:	2013-11-13
Date of sequence modification	:	2011-02-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	large ribosomal subunit; rRNA binding; structural constituent of ribosome; translation
GO identifier	:	GO:0015934; GO:0019843; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L22P family

Protein sequence

Length

118 residues

>E4QX46|E4QX46_HAEI6 Haemophilus influenzae R2866
METIAKHRYARTSAQKARLVADLIRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSDR