HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QX23

Names and origin
Entry : E4QX23 (unreviewed)
Entry name : E4QX23_HAEI6
Protein names : Ribosome maturation factor RimM
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : rimM
ORF names : R2866_0385
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA processing; ribosomal small subunit biogenesis; ribosome; ribosome binding
GO identifier : GO:0006364; GO:0042274; GO:0005840; GO:0043022
Keywords
Ligand & Biological process : Chaperone; Complete proteome; Cytoplasm; Ribosome biogenesis
General annotation
Domains : PRC barrel domain (1)
Sequence similarities : Belongs to RimM family
Subcellular location : Cytoplasm.
Protein sequence
Length : 187 residues
>E4QX23|E4QX23_HAEI6 Haemophilus influenzae R2866
MEQQRIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHN
HEIIVKLKGVDDREAAQILANVEIGVDLSVFPELEEGDYYWHDLIGCTVVNLEGYTMGTV
TEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVDWDAGF