HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QX22

Names and origin
Entry : E4QX22 (unreviewed)
Entry name : E4QX22_HAEI6
Protein names : 30S ribosomal protein S16
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : rpS16
ORF names : rpsP
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein S16P family
Protein sequence
Length : 90 residues
>E4QX22|E4QX22_HAEI6 Haemophilus influenzae R2866
MVTIRLSRGGAKKRPFYQIVVADSRSPRDGRFIEPVGFFNPIAQGNAERLRINLERVNHW
VAQGASLSDRVASLVKEAQKAA