HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWY9

Names and origin
Entry : E4QWY9 (unreviewed)
Entry name : E4QWY9_HAEI6
Protein names : Putative oxidoreductase
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yfgD
ORF names : R2866_0347
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : arsenate reductase (glutaredoxin) activity
GO identifier : GO:0008794
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 124 residues
>E4QWY9|E4QWY9_HAEI6 Haemophilus influenzae R2866
MSVIIYHNPHCSKSRETLALLENKGIQPIIELYLQKQYSVNELQSIAKKLGIDDVRQMMR
TKDELYKSLNLDNLDLSQAELFKAMSEHSALIERPIVINGDKAKIGRPPETVLEIL