HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWX4

Names and origin
Entry : E4QWX4 (unreviewed)
Entry name : E4QWX4_HAEI6
Protein names : Biopolymer transport protein ExbB
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : exbB
ORF names : R2866_0332
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; protein transporter activity
GO identifier : GO:0016021; GO:0008565
Keywords
Ligand & Biological process : Complete proteome; Membrane; Protein transport; Transmembrane; Transport
General annotation
Sequence similarities : Belongs to ExbB/tolQ family
Subcellular location : Membrane; Multi-pass membrane protein.
Protein sequence
Length : 162 residues
>E4QWX4|E4QWX4_HAEI6 Haemophilus influenzae R2866
MVQLFDFLQQYSDYFIIGLLLLMSIIMLAMVIERYLFLRKVSVAHYSTIHALDIDLNRNM
TVISTIGANAPYVGLLGTVIGILLTFYQIGHGGGDIDPSVIMLHLSLALKATALGILVAI
PSMVFYNGLGRKVEVNRLKWKVLSEQKDKE