HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWX0

Names and origin
Entry : E4QWX0 (unreviewed)
Entry name : E4QWX0_HAEI6
Protein names : Ribosome binding protein Y
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yfiA
ORF names : R2866_0328
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : primary metabolic process
GO identifier : GO:0044238
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 115 residues
>E4QWX0|E4QWX0_HAEI6 Haemophilus influenzae R2866
MTLNITSKQMDITPAIREHLEERLAKLGKWQTQLISPHFVLNKVPNGFSVEASIGTPLGN
LLASATSDDMYKAINEVEEKLERQLNKLQHKSESRRADERLKDSFEN