HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWV7

Names and origin
Entry : E4QWV7 (unreviewed)
Entry name : E4QWV7_HAEI6
Protein names : 50S ribosomal protein L30
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : rpL30
ORF names : rpmD
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : large ribosomal subunit; structural constituent of ribosome; translation
GO identifier : GO:0015934; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L30P family
Protein sequence
Length : 63 residues
>E4QWV7|E4QWV7_HAEI6 Haemophilus influenzae R2866
MAKTIKVTQVRSSIARLPKHKATLRGLGLRHMHHTVELIDTPAVRGMINQVSYMVKVEE