HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWT9

Names and origin
Entry : E4QWT9 (unreviewed)
Entry name : E4QWT9_HAEI6
Protein names : Carbon storage regulator homolog
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : csrA
ORF names : R2866_1580
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; mRNA catabolic process; regulation of carbohydrate metabolic process
GO identifier : GO:0003723; GO:0006402; GO:0006109
Keywords
Ligand & Biological process : Complete proteome; RNA-binding
General annotation
Sequence similarities : Belongs to CsrA family
Protein sequence
Length : 71 residues
>E4QWT9|E4QWT9_HAEI6 Haemophilus influenzae R2866
MLILTRKVGESVLIGDDISITVLSVRGNQVKLGVEAPKEVSVHREEIYQRIKQTKDEPYL
GSS