HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWT7

Names and origin
Entry : E4QWT7 (unreviewed)
Entry name : E4QWT7_HAEI6
Protein names : Universal stress protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : uspA
ORF names : R2866_1578
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; response to stress
GO identifier : GO:0005737; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm
General annotation
Sequence similarities : Belongs to Universal stress protein A family
Subcellular location : Cytoplasm.
Protein sequence
Length : 153 residues
>E4QWT7|E4QWT7_HAEI6 Haemophilus influenzae R2866
MYKHILVAVDLSEESPILLKKAVGIAKRHDAKLSIIHVDVNFSDLYTGLIDVNMSSMQDR
ISTETQKALLDLAESVDYPISEKLSGSGDLGQVLSDAIEQYDVDLLVTGHHQDFWSKLMS
STRQVMNTIKIDMLVVPLRDE