HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWS2

Names and origin
Entry : E4QWS2 (unreviewed)
Entry name : E4QWS2_HAEI6
Protein names : Trp operon repressor homolog
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : trpR
ORF names : R2866_1563
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; negative regulation of transcription, DNA-dependent; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0005737; GO:0045892; GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA-binding; Repressor; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to TrpR family
Subcellular location : Cytoplasm.
Protein sequence
Length : 109 residues
>E4QWS2|E4QWS2_HAEI6 Haemophilus influenzae R2866
MYISRNLEQWNAFLQMLKIAFEENKAQEFLTLLLTADERDAVGLRLQIVSQLIDKNMPQR
EIQQNLNTSAATITRGSNMIKTMDPDFMQWMKQHLDLIEKN