HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWR9

Names and origin
Entry : E4QWR9 (unreviewed)
Entry name : E4QWR9_HAEI6
Protein names : Fumarate reductase subunit C
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : frdC
ORF names : R2866_1560
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; oxidoreductase activity; plasma membrane
GO identifier : GO:0016021; GO:0016491; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Oxidoreductase; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FrdC family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 148 residues
>E4QWR9|E4QWR9_HAEI6 Haemophilus influenzae R2866
MSVTVSKRKKYVRPMTATWWQKLDFYKAYMLREATSVFAVWFCIVLLYGVLCFASNPMPG
LGILSFIEFLRNPIVVFLNIITLIATLYHTVTYFLMTPKVMNIIVKNERLPHTVVRNALW
AVTALVSVIALVLVYI