HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWR4

Names and origin
Entry : E4QWR4 (unreviewed)
Entry name : E4QWR4_HAEI6
Protein names : Outer membrane protein assembly factor BamE
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : smpA
ORF names : bamE
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : Gram-negative-bacterium-type cell outer membrane assembly; cell outer membrane; plasma membrane; protein insertion into membrane
GO identifier : GO:0043165; GO:0009279; GO:0005886; GO:0051205
Keywords
Ligand & Biological process : Cell membrane; Cell outer membrane; Complete proteome; Lipoprotein; Membrane; Palmitate; Signal
General annotation
Sequence similarities : Belongs to BamE family
Subcellular location : Cell outer membrane; Lipid-anchor.
Protein sequence
Length : 149 residues
>E4QWR4|E4QWR4_HAEI6 Haemophilus influenzae R2866
MQVKTLLGATFLALSLASCSTVEKVVYRIDVPQGNYLEATTVAQVKEGMTAQQVQYLLGT
PVLIDPYNNYTWYYVFLQQRAYETPAQHTLTVKFDQRGIVTETHLDKPLPEVSQQGENNT
IIETGEKPKSSWWKFWK