HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWR2

Names and origin
Entry : E4QWR2 (unreviewed)
Entry name : E4QWR2_HAEI6
Protein names : UPF0352 protein R2866_1553
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yejL
ORF names : R2866_1553
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0352 family
Protein sequence
Length : 80 residues
>E4QWR2|E4QWR2_HAEI6 Haemophilus influenzae R2866
MAQHSKYSDAQLSAIVNDMIAVLEKHKAPVDLSLIALGNMASNLLTTSVPQTQREALAQA
FSNSLINAVKTR