HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWP5

Names and origin
Entry : E4QWP5 (unreviewed)
Entry name : E4QWP5_HAEI6
Protein names : Z-ring associated protein ZapA
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : zapA
ORF names : R2866_1536
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytoplasm
GO identifier : GO:0000917; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Complete proteome; Cytoplasm; Septation
General annotation
Subcellular location : Cytoplasm.
Protein sequence
Length : 108 residues
>E4QWP5|E4QWP5_HAEI6 Haemophilus influenzae R2866
MSLKLVEILVLGQVLRLNVPIEQEELLRQAARNLDILVSEMKEKTGLIQLDRVLSIVALN
LSFELSQEKNKTAKIEEVLRTGIQQLDHSLENIRVTKEPH