HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWM9

Names and origin
Entry : E4QWM9 (unreviewed)
Entry name : E4QWM9_HAEI6
Protein names : Truncated tRNA-dihydrouridine synthase YohI
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yohI
ORF names : R2866_0313
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : flavin adenine dinucleotide binding; tRNA dihydrouridine synthase activity; tRNA dihydrouridine synthesis
GO identifier : GO:0050660; GO:0017150; GO:0002943
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 119 residues
>E4QWM9|E4QWM9_HAEI6 Haemophilus influenzae R2866
MRVILAPMQGVLDPFVRQLLTEVNDYDLCITEFVRVVDQLLPEKVFYRLCPELKNQGFTS
SGTPVRVQLLGQHPECLGMRFKKSCKNMRMSKMNMTAVFIMWHELNNGYVI