HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWK7

Names and origin
Entry : E4QWK7 (unreviewed)
Entry name : E4QWK7_HAEI6
Protein names : Copper-responsive transcriptional regulator
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : copR
ORF names : R2866_0286
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : DNA binding; copper ion binding; nucleotide binding; positive regulation of transcription, DNA-dependent; sequence-specific DNA binding transcription factor activity
GO identifier : GO:0003677; GO:0005507; GO:0000166; GO:0045893; GO:0003700
Keywords
Ligand & Biological process : Complete proteome; DNA-binding
General annotation
Domains : HTH merR-type DNA-binding domain (1)
Protein sequence
Length : 140 residues
>E4QWK7|E4QWK7_HAEI6 Haemophilus influenzae R2866
MNISEAAKLVGLSTKQIRDYEKIGLIKPAVRSLSGYRNYGESDLERLHFIRHSRNVGFSL
HQIAQLLALQDNPKRSCREVKVLTAQHIATLNQQIEQLQKMVQKLQHWHDSCQGNDNPEC
LILNGLNG