HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWD1

Names and origin
Entry : E4QWD1 (unreviewed)
Entry name : E4QWD1_HAEI6
Protein names : DNA gyrase inhibitor YacG
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yacG
ORF names : R2866_1491
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA topoisomerase (ATP-hydrolyzing) inhibitor activity; negative regulation of DNA topoisomerase (ATP-hydrolyzing) activity; regulation of transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0008657; GO:2000372; GO:0006355; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Metal-binding; Zinc
General annotation
Sequence similarities : Belongs to DNA gyrase inhibitor YacG family
Protein sequence
Length : 76 residues
>E4QWD1|E4QWD1_HAEI6 Haemophilus influenzae R2866
MPDEMIEVPCPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDPN
VSDEWSIK