HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QWB9

Names and origin
Entry : E4QWB9 (unreviewed)
Entry name : E4QWB9_HAEI6
Protein names : Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : lgt
ORF names : R2866_1479
EC number : 2.4.99.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; lipoprotein biosynthetic process; phosphatidylglycerol-prolipoprotein diacylglyceryl transferase activity; plasma membrane; protein lipoylation
GO identifier : GO:0016021; GO:0042158; GO:0008961; GO:0005886; GO:0009249
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Glycosyltransferase; Lipoprotein; Membrane; Transferase; Transmembrane; Transmembrane helix
General annotation
Pathway : Protein modification; lipoprotein biosynthesis (diacylglyceryl transfer).
Sequence similarities : Belongs to Lgt family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 288 residues
>E4QWB9|E4QWB9_HAEI6 Haemophilus influenzae R2866
MNSNYLLLPHFDPSIFTLGDSNIGLRWYGLMYLLGFVFARWLAVRRANRPNSGWTVDQVD
SLLFNGFMGVFIGGRVGDVFFYNLDHFLQEPLYLFRVWEGGMSFHGGLIGVIVAMIWTSY
SQKRNFWQTADFVAPLIPFGLGLGRIGNFINLELWGRETNVPWAMIFPNDPLLLPRHPSQ
LYEAFLEGLVLFAILNIFIKKPRPMASVAGLFLIGYGVFRFIVEYVREPEVENFFGIITR
GQALCLPMIIGGAFIMAWAYSRKSAVIK