HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E4QW79

Names and origin

Entry	:	E4QW79 (unreviewed)
Entry name	:	E4QW79_HAEI6
Protein names	:	Glutamine synthetase regulatory protein P-II
Organism	:	Haemophilus influenzae R2866
Organism ID	:	262728
Gene names	:	glnB
ORF names	:	R2866_0236

History

Date of creation	:	2011-02-08
Date of modification	:	2013-11-13
Date of sequence modification	:	2011-02-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of catalytic activity; regulation of nitrogen utilization; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier	:	GO:0030234; GO:0050790; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Complete proteome; Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>E4QW79|E4QW79_HAEI6 Haemophilus influenzae R2866
MKKIEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTELYRGAEYMVDFLPKVK
LEVVVPDELVDQCIEAIVETAQTGKIGDGKIFVYHVERAIRIRTGEENEDAI