HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QW47

Names and origin
Entry : E4QW47 (unreviewed)
Entry name : E4QW47_HAEI6
Protein names : Fe-S cluster related protein IscX
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : iscX
ORF names : R2866_0204
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : iron-sulfur cluster assembly
GO identifier : GO:0016226
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 72 residues
>E4QW47|E4QW47_HAEI6 Haemophilus influenzae R2866
MKWTDAQLIAEELYDRNPDLDPKTVRFTDLHKWICELEDFDDDPNKSNESILEAILLKWL
DEFE