HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QW46

Names and origin
Entry : E4QW46 (unreviewed)
Entry name : E4QW46_HAEI6
Protein names : [2FE-2S] ferredoxin, electron carrer protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : fdx-1
ORF names : R2866_0203
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; electron carrier activity; metal ion binding
GO identifier : GO:0051537; GO:0009055; GO:0046872
Keywords
Ligand & Biological process : Complete proteome; Iron; Iron-sulfur; Metal-binding
Protein sequence
Length : 121 residues
>E4QW46|E4QW46_HAEI6 Haemophilus influenzae R2866
MPKVIFLPNEDFCPEGMVVDAATGDNLLEVAHNAGVEIHHACDGSCACTTCHVIVREGFD
SLNETSDQEEDMLDKAWGLEMDSRLSCQCVVGNEDLVVEIPKYNLNHANEAAH