HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QW39

Names and origin
Entry : E4QW39 (unreviewed)
Entry name : E4QW39_HAEI6
Protein names : Transcriptional regulator IscR
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : iscR
ORF names : R2866_0196
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; double-stranded DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0051537; GO:0003690; GO:0046872; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : 2Fe-2S; Activator; Complete proteome; DNA-binding; Iron; Iron-sulfur; Metal-binding; Repressor; Transcription; Transcription regulation
Protein sequence
Length : 162 residues
>E4QW39|E4QW39_HAEI6 Haemophilus influenzae R2866
MKLTSKGRYAVTAVLDIALNTDGGPVSLADISERQHISLSYLEQLFAKLRKDGLVKSVRG
PGGGYQLGLPSEQISVGMIIAAVNENIHVTKCLGRENCKNGVECLTHELWQDLSLRIESF
LNEITLAELVNKRNVKRQSHRDFNNLLVNQ