HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QW37

Names and origin
Entry : E4QW37 (unreviewed)
Entry name : E4QW37_HAEI6
Protein names : Peptidoglycan-associated outer membrane lipoprotein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : pal
ORF names : R2866_0192
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell outer membrane; integral to membrane; plasma membrane
GO identifier : GO:0009279; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Lipoprotein; Membrane
General annotation
Sequence similarities : Belongs to OmpA family
Protein sequence
Length : 165 residues
>E4QW37|E4QW37_HAEI6 Haemophilus influenzae R2866
MNKFVKSLLVAGSVAALAACSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDI
TGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDA
GKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY