HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QW34

Names and origin
Entry : E4QW34 (unreviewed)
Entry name : E4QW34_HAEI6
Protein names : Outer membrane integrity protein TolR
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : tolR
ORF names : R2866_0189
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; protein transport; transporter activity
GO identifier : GO:0016021; GO:0015031; GO:0005215
Keywords
Ligand & Biological process : Complete proteome; Membrane; Protein transport; Transmembrane; Transport
General annotation
Sequence similarities : Belongs to ExbD/tolR family
Subcellular location : Membrane; Single-pass type II membrane protein.
Protein sequence
Length : 151 residues
>E4QW34|E4QW34_HAEI6 Haemophilus influenzae R2866
MARRQRKAIKSEINIVPFLDVLLVLVLIFMATAPIISQSVQVELPDSVQSQEVSNEDKVP
VILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKA
LNLLHLAGIKSVGLMTNPI