HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QW05

Names and origin
Entry : E4QW05 (unreviewed)
Entry name : E4QW05_HAEI6
Protein names : Hypothetical outer membrane protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
ORF names : R2866_0159
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cell outer membrane; integral to membrane
GO identifier : GO:0009279; GO:0016021
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 110 residues
>E4QW05|E4QW05_HAEI6 Haemophilus influenzae R2866
MQADWVHAREKIEIHNPNQPEILQDYSYIKTHSNHPRFSIGYDFGNWRLALDYSHYDRCL
ENVRFKTHEASFGVRYRFQLNKFSFLFKRSNSSHYLQNEGKI