HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QW02

Names and origin
Entry : E4QW02 (unreviewed)
Entry name : E4QW02_HAEI6
Protein names : Transcriptional repressor NrdR
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : nrdR
ORF names : R2866_1439
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; DNA binding; negative regulation of transcription, DNA-dependent; transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0005524; GO:0003677; GO:0045892; GO:0006351; GO:0008270
Keywords
Ligand & Biological process : ATP-binding; Complete proteome; DNA-binding; Metal-binding; Nucleotide-binding; Repressor; Transcription; Transcription regulation; Zinc; Zinc-finger
General annotation
Domains : ATP-cone domain (1)
Sequence similarities : Belongs to NrdR family
Protein sequence
Length : 161 residues
>E4QW02|E4QW02_HAEI6 Haemophilus influenzae R2866
MHCPFCDTEETKVIDSRLVSDGYQVRRRRECGHCHERFTTFEMAELIIPKIIKTDGTREP
FNEDKLRSGIQHALEKRPVSADDVEKAINHIILQLRATGEREVPSKLVGKLAMNELKKLD
KVAYIRFASVYLSFDDIDQFTIEIEKLKD