HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVZ7

Names and origin
Entry : E4QVZ7 (unreviewed)
Entry name : E4QVZ7_HAEI6
Protein names : Probable ribonuclease VapC (Probable RNase VapC) (EC 3.1.-.-) (Toxin VapC)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : vapC2
ORF names : vapC
EC number : 3.1.-.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : magnesium ion binding; nucleic acid phosphodiester bond hydrolysis; ribonuclease activity
GO identifier : GO:0000287; GO:0090305; GO:0004540
Keywords
Ligand & Biological process : Complete proteome; Hydrolase; Magnesium; Metal-binding; Nuclease; Toxin
General annotation
Sequence similarities : Belongs to PINc/VapC protein family
Protein sequence
Length : 144 residues
>E4QVZ7|E4QVZ7_HAEI6 Haemophilus influenzae R2866
MLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAGI
EDFLSRLTILDYQPKHAAHFGNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREF
ERVIALRTENWV