HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVY9

Names and origin
Entry : E4QVY9 (unreviewed)
Entry name : E4QVY9_HAEI6
Protein names : Nucleoid occlusion factor SlmA
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : slmA
ORF names : R2866_1426
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : bacterial nucleoid; cell cycle; cell division; cytoplasm; negative regulation of barrier septum assembly; sequence-specific DNA binding
GO identifier : GO:0043590; GO:0007049; GO:0051301; GO:0005737; GO:0010974; GO:0043565
Keywords
Ligand & Biological process : Cell cycle; Cell division; Complete proteome; Cytoplasm; DNA-binding
General annotation
Domains : HTH tetR-type DNA-binding domain (1)
Sequence similarities : Belongs to Nucleoid occlusion factor SlmA family
Subcellular location : Cytoplasm › nucleoid.
Protein sequence
Length : 234 residues
>E4QVY9|E4QVY9_HAEI6 Haemophilus influenzae R2866
MVEEQLSLSGVEEIAPKIETPKIEKRTVKERRQQVLTVLIHMLHSERGMERMTTARLAKE
VGVSEAALYRYFPSKTKMFEALIEHIESTLLSRITASMRNETQTMNRIHDILQTILDFAR
KNPGLTRVLTGHALMFEEAQLQARVAQFFDRLEMQFVNILQMRKLREGRAFNVDERIIAS
HLVTLCEGQFMRYVRTNFRLNSSQSFEQQWRFIEPLFA