HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVY8

Names and origin
Entry : E4QVY8 (unreviewed)
Entry name : E4QVY8_HAEI6
Protein names : UPF0270 protein R2866_1425
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yheU
ORF names : R2866_1425
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0270 family
Protein sequence
Length : 91 residues
>E4QVY8|E4QVY8_HAEI6 Haemophilus influenzae R2866
MIIPWQELEAETLDNIVESVILREGTDYGIEELSLNQKKQLLLTQIRNGIALIVWSELHE
SIDIKNKTEFLKQECKEQECQMN