HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVY3

Names and origin
Entry : E4QVY3 (unreviewed)
Entry name : E4QVY3_HAEI6
Protein names : Purine nucleoside phosphoramidase (EC 3.9.1.-)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : hinT
ORF names : R2866_1420
EC number : 3.9.1.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : hydrolase activity; metabolic process
GO identifier : GO:0016787; GO:0008152
Keywords
Ligand & Biological process : Complete proteome; Hydrolase
Protein sequence
Length : 124 residues
>E4QVY3|E4QVY3_HAEI6 Haemophilus influenzae R2866
MAEETIFSKIIRKEIPANIVYQDELVTAFRDISPQAKTHILIIPNKVIPTVNDVTEQDEV
ALGRLFSVAAKLAKEEGVAEDGYRLIVNCNKHGGQEVFHLHMHLVGGEPLGRMLAK