HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVW6

Names and origin
Entry : E4QVW6 (unreviewed)
Entry name : E4QVW6_HAEI6
Protein names : DNA-binding protein fis
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : fis
ORF names : R2866_1403
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : regulation of transcription, DNA-dependent; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0006355; GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Activator; Complete proteome; DNA-binding; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to Transcriptional regulatory fis family
Protein sequence
Length : 107 residues
>E4QVW6|E4QVW6_HAEI6 Haemophilus influenzae R2866
MLEQQRNPADALTVSVLNAQSQVTSKPLRDSVKQALRNYLAQLDGQDVNDLYELVLAEVE
HPMLDMIMQYTRGNQTRAANMLGINRGTLRKKLKKYGMG