HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVU7

Names and origin
Entry : E4QVU7 (unreviewed)
Entry name : E4QVU7_HAEI6
Protein names : Putative membrane protein insertion efficiency factor
Organism : Haemophilus influenzae R2866
Organism ID : 262728
ORF names : R2866_1384
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane
GO identifier : GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane
General annotation
Sequence similarities : Belongs to UPF0161 family
Subcellular location : Cell inner membrane; Peripheral membrane protein; Cytoplasmic side.
Protein sequence
Length : 94 residues
>E4QVU7|E4QVU7_HAEI6 Haemophilus influenzae R2866
MAETHSLGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKR
VLKCHPLNAGGFDPVPPKTNNNDEKK