HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVU0

Names and origin
Entry : E4QVU0 (unreviewed)
Entry name : E4QVU0_HAEI6
Protein names : Putative DNA uptake protein ComE1
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : comE1
ORF names : R2866_1377
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : DNA binding; DNA repair
GO identifier : GO:0003677; GO:0006281
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 120 residues
>E4QVU0|E4QVU0_HAEI6 Haemophilus influenzae R2866
MKTLFTSVVLCSALVASSSFAEEKATEQTAQPVVATQAEAQVAPAVVSDKLNINTATASE
IQKSLTGIGAKKAEAIVQYREKHGNFTNAEQLLEVQGIGKATLEKNRDRIIF