HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVR3

Names and origin
Entry : E4QVR3 (unreviewed)
Entry name : E4QVR3_HAEI6
Protein names : Disulfide bond formation protein B (Disulfide oxidoreductase)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : dsbB
ORF names : R2866_0147
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : electron carrier activity; integral to membrane; plasma membrane; protein disulfide oxidoreductase activity
GO identifier : GO:0009055; GO:0016021; GO:0005886; GO:0015035
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Chaperone; Complete proteome; Disulfide bond; Electron transport; Membrane; Oxidoreductase; Redox-active center; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to DsbB family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 189 residues
>E4QVR3|E4QVR3_HAEI6 Haemophilus influenzae R2866
MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGII
ALLQPRAFILRLIALALGLFSSIKGLLISFRHLDLQMNPAPWKQCEFIPNFPETLPFHQW
FPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIAQVIKTRKQRRLFN