HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVR1

Names and origin
Entry : E4QVR1 (unreviewed)
Entry name : E4QVR1_HAEI6
Protein names : DNA-binding protein HU-alpha
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : hupA
ORF names : R2866_0145
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; chromosome condensation
GO identifier : GO:0003677; GO:0030261
Keywords
Ligand & Biological process : Complete proteome; DNA condensation; DNA-binding
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Protein sequence
Length : 98 residues
>E4QVR1|E4QVR1_HAEI6 Haemophilus influenzae R2866
MNKTDLIDAIANAAELNKKQAKAALEATLDAITASLKEGEPVQLIGFGTFKVNERAARTG
RNPQTGAEIQIAASKVPAFVSGKALKDAIK