HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVP9

Names and origin
Entry : E4QVP9 (unreviewed)
Entry name : E4QVP9_HAEI6
Protein names : Nucleoid-associated protein R2866_0133
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : ybaB
ORF names : R2866_0133
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; bacterial nucleoid; cytoplasm
GO identifier : GO:0003677; GO:0043590; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA-binding
General annotation
Sequence similarities : Belongs to YbaB/EbfC family
Subcellular location : Cytoplasm › nucleoid.
Protein sequence
Length : 117 residues
>E4QVP9|E4QVP9_HAEI6 Haemophilus influenzae R2866
MFGKGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPS
LMEDDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF