HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVP6

Names and origin
Entry : E4QVP6 (unreviewed)
Entry name : E4QVP6_HAEI6
Protein names : Protein-export membrane protein SecG
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : secG
ORF names : R2866_0130
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : P-P-bond-hydrolysis-driven protein transmembrane transporter activity; integral to membrane; protein secretion
GO identifier : GO:0015450; GO:0016021; GO:0009306
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 121 residues
>E4QVP6|E4QVP6_HAEI6 Haemophilus influenzae R2866
MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA
TAFFVIALVLGNMNSHKGNVQKGTFDDLSQAAEQVQQQQAAPAKDNKNSDIPQ