HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVP1

Names and origin
Entry : E4QVP1 (unreviewed)
Entry name : E4QVP1_HAEI6
Protein names : Toxin/antitoxin locus vapDX, toxin protein VapD
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : vapD
ORF names : R2866_0124
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 49 residues
>E4QVP1|E4QVP1_HAEI6 Haemophilus influenzae R2866
MYAIAFDLVVKGTQDYHPKGVQQAYTDIGAFRIEQWSDFTDFIRN