HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVL9

Names and origin
Entry : E4QVL9 (unreviewed)
Entry name : E4QVL9_HAEI6
Protein names : Imidazole glycerol phosphate synthase subunit HisH (EC 2.4.2.-) (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit HisH) (ImGP synthase subunit HisH)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : hisH
ORF names : R2866_0101
EC number : 2.4.2.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; glutamine metabolic process; histidine biosynthetic process; imidazoleglycerol-phosphate synthase activity
GO identifier : GO:0005737; GO:0006541; GO:0000105; GO:0000107
Keywords
Ligand & Biological process : Amino-acid biosynthesis; Complete proteome; Cytoplasm; Glutamine amidotransferase; Glycosyltransferase; Histidine biosynthesis; Transferase
General annotation
Domains : Glutamine amidotransferase type-1 domain (1)
Pathway : Amino-acid biosynthesis; L-histidine biosynthesis; L-histidine from 5-phospho-alpha-D-ribose 1-diphosphate: step 5/9.
Subcellular location : Cytoplasm.
Protein sequence
Length : 215 residues
>E4QVL9|E4QVL9_HAEI6 Haemophilus influenzae R2866
MTNITIIDTGCANLSSVKFAFDRLGYNTEITFDLNKIKSADKLILPGVGTANAAMYNLQE
RQLIETIQNLTQPVLGICLGMQLMTEFSEEGNVPTLNLISGKTNRIPDTGLPLPQMGWNR
VQFVKNCPLFDGIVQNSHFYFVHSYAVSPNEHSVAISNYGVNFSAAIAKENFYGVQFHPE
RSGKNGALLLKNFVEKVPF